.
The Open Protein Structure Annotation Network
PDB Keyword
.

2isb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Fumarase of FUM-1 (NP_069927.1) from Archaeoglobus Fulgidus at 1.66 A resolution. To be published
    Site JCSG
    PDB Id 2isb Target Id 356698
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS1365,NP_069927.1, 289774, 289682 Molecular Weight 19925.25 Da.
    Residues 180 Isoelectric Point 5.98
    Sequence mvmeyelrtplvkdqilklkvgdvvyitgeiftardeaharalewmeegkelpfsfdkgvvyhcgplvk kndewrvvsagpttsarmnpftpkilekvecmgiigkggmseevveamrgkaayfaftggagalaamsi kkvkgvvwedlgmpeavwlleverfgpcivaidahgnslyrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.66 Rfree 0.197
    Matthews' coefficent 2.40 Rfactor 0.174
    Waters 182 Solvent Content 48.84

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2isb
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The NP_069927 from A. fulgidus and its homologs are present in archaea and bacteria and belongs to a protein family (PF05683), that consists of the C-terminal region of tartrate dehydratase beta subunit / fumarate hydratase class I.


    Analysis of the crystallographic packing of NP_069927 using the PQS server {Henrick, 1998 #73} indicates that a monomer is the biologically relevant form.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch