.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iiu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of conserved hypothetical protein (NP_719307.1) from Shewanella Oneidensis MR-1 at 2.28 A resolution. To be published
    Site JCSG
    PDB Id 2iiu Target Id 366232
    Related PDB Ids 2olt 
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS1475,NP_719307.1, PF01865, 90350 Molecular Weight 25518.24 Da.
    Residues 226 Isoelectric Point 4.73
    Sequence mpvnsilgvfakspikplqehmdkvydcasllvpffeatitgnwddavqirkqislaekqgdslkreir ltlpsglfmpvertdllelltqqdkiankakdisgrvigrqllipqalqvpfiaylqrcidavglaqqv inelddlleagfrgrevdfvakmineldiieedtddlqiqlrrqlfaleselnpvdvmflyktiewvgg ladlaervgsrlelmlarv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.28 Rfree 0.247
    Matthews' coefficent 2.70 Rfactor 0.2
    Waters 203 Solvent Content 54.08

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2iiu
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     

    Protein Summary

    The gene SO_3770 from Shewanella oneidensis encodes a phosphate transport regulator (66% sequence identity with a homologue from Vibrio vulnificus), and a member of the PhoU family ( PF01865).  

    The protein structure, 2iiu, belongs to the class of all alpha proteins and adopts a spectrin repeat-like fold type SCOP46965.  2iiu is highly similar to PhoU homologue from Thermotoga maritima 1SUM (Dali Z-score=19). The given structure does not contain multinuclear iron cluster; however it does contain the conserved motif E(D)XXXD (EEDTDD) capable of coordinating this type of iron clusters.

    Inorganic phosphate (Pi) uptake is of fundamental importance in the cell physiology of bacteria because Pi is required as a nutrient.  Two distinct systems for the uptake of Pi have been described: the low affinity phosphate inorganic transporter and the high affinity phosphate-specific transporter (PstSCAB).  When the preferred Pi source is in excess, it is taken up by the phosphate inorganic transporter.  The PstSCAB transporter belongs to the superfamily of ATP-binding cassette transporters and is encoded by the Pst operon.  The Pst operon is part of the phosphate (PHO) regulon.  The PHO regulon is repressed by the PhoU protein under conditions of  an excess of extracellular Pi. [Ref]

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch