.
The Open Protein Structure Annotation Network
PDB Keyword
.

2icg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_472245.1) from Listeria Innocua at 1.65 A resolution. To be published
    Site JCSG
    PDB Id 2icg Target Id 368054
    Molecular Characteristics
    Source Listeria innocua clip11262
    Alias Ids TPS1532,NP_472245.1, BIG_12, BIG_234, 86217 Molecular Weight 17415.72 Da.
    Residues 159 Isoelectric Point 4.53
    Sequence massfleevdrlitlsgitfhasgtgtpelikiyqdalgnefpetyklflekygtltfngvsfygiskr glsaasipdvkfateqartfgdinkemimiknsgygsifsidtsiigsegepvivetnlsfkdntekkv vansfgeflleeielsltdlg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.235
    Matthews' coefficent 2.57 Rfactor 0.198
    Waters 173 Solvent Content 52.13

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2icg
    1. A novel immunity system for bacterial nucleic acid degrading toxins and its recruitment in various eukaryotic and DNA viral systems
    D Zhang, LM Iyer, L Aravind - Nucleic acids research, 2011 - Oxford Univ Press
     

    Protein Summary

    The NP_472245 from L. innocua is a "founding member" of a large family (~250 homologs) of uncharacterized (hypothetical) proteins found mostly in gram positive bacteria, but also in fungi, termed SMI/KNR4 group (PF09346).  A domain homologous to this family is a second domain in a three domain COG family COG4282 (Proteins involved in beta-1,3-glucan synthesis).

     

    SCOP classifies 2icg inside the alpha+beta class, SMI/KNR4-like (super)family. JCSG solved a third protein from this family (2prv), while the NY center solved the second (2pag). Analysis of the crystallographic packing of 2icg using the PQS server {Henrick, 1998 #73} indicates that a hexamer, as a dimer of trimers in which each subunit makes significant contacts with four others, is the biologically relevant form. Alternatively, a different crystalographically generated dimer, mainly formed through hydrogen bonds between backbone atoms, could be biologically relevant. Neither structural homolog retains one of these quaternary structures.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch