The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative tail lysozyme (NP_952040.1) from GEOBACTER SULFURREDUCENS at 1.44 A resolution. To be published
    Site JCSG
    PDB Id 2ia7 Target Id 367993
    Molecular Characteristics
    Source Geobacter sulfurreducens pca
    Alias Ids TPS1530,NP_952040.1, BIG_139, 90837 Molecular Weight 14817.18 Da.
    Residues 133 Isoelectric Point 5.26
    Sequence mtkareflgtgwkfpvaagadgamvlssaeediaesiriilgtargervmrpdfgcgihdrvfsvintt tlglienevkealilwepriellsvtaspreaaegrllidieyrvrstntrfnlvypfylkesa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.44 Rfree 0.203
    Matthews' coefficent 1.97 Rfactor 0.168
    Waters 120 Solvent Content 37.10

    Ligand Information


    Google Scholar output for 2ia7
    1. Structural biology of type VI secretion systems
    E Cascales, C Cambillau - of the Royal , 2012 - rstb.royalsocietypublishing.org
    2. Contractile Tail Machines of Bacteriophages
    PG Leiman, MM Shneider - Viral Molecular Machines, 2012 - Springer
    3. Solution NMR and X-ray crystal structures of membrane-associated Lipoprotein-17 domain reveal a novel fold
    R Mani, S Vorobiev, GVT Swapna, H Neely - Journal of Structural and , 2011 - Springer

    Protein Summary

    The NP_952040 from G. sulfurreducens - is similar to bacterial proteins also present in viruses from GPW / gp25 protein family (Pfam04965), defined as putative structural component of the outer wedge of the baseplate that has acidic lysozyme activity. This definition may be supported by NP_952040 genomic neighborhood and phylogenetic cooccurrence with the following proteins:
    GSU0975[AAR34302] Phage tail sheath protein (putative);
    GSU0982[AAR34309] Hypothetical protein;
    GSU0985[AAR34312] Hypothetical protein;
    GSU0972[AAR34299] ATPase (AAA family);
    GSU0983[AAR34310] Hypothetical protein.

    Analysis of the crystallographic packing of PE00139F using the PQS server {Henrick, 1998 #73} indicates that a monomer is the biologically relevant form.

    NP_952040 has structure similar to Xaa-Pro dipeptidase (PDB:1pv9; DALI Z-score 4.9; RMSD 3.8; 8% sequence identity within 84 superimposed residues), pantothenate synthetase (PDB:1iho; DALI Z-score 4.6, RMSD 3.7, 13% sequence identity for 76 superimposed residues), and PDB:2iec (DALI Z-score 4.4; RMSD 2.8; 11% sequence identity for 76 superimposed residues).

    There are two separate clusters of conserved residues:
    (a) Glu35, Ser36, Ile40, Thr43, Gly46, Met50, Arg51, Pro52, Phe54, Trp85, Glu86, Pro87, Arg88.
    (b) Ile58, Phe63, Ile74.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch