.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i6g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative METHYLTRANSFERASE (16420133) from SALMONELLA TYPHIMURIUM LT2 at 1.90 A resolution. To be Published
    Site JCSG
    PDB Id 2i6g Target Id 359588
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS1424,16420133, 87269 Molecular Weight 22142.95 Da.
    Residues 198 Isoelectric Point 5.00
    Sequence mtvrdenyftekygltrthsdvlaaakvvapgrtldlgcgngrnslylaangydvtawdknpasmanle rikaaegldnlqtdlvdlntltfdgeydfilstvvmmfleaqtipglianmqrctkpggynlivaamdt pdfpctvgfpfafkegelrryyegwdmlkynedvgelhrtdengnriklrfatmlarkta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.233
    Matthews' coefficent 2.29 Rfactor 0.19
    Waters 388 Solvent Content 45.81

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2i6g
    1. New surface contacts formed upon reductive lysine methylation: Improving the probability of protein crystallization
    P Sledz, H Zheng, K Murzyn, M Chruszcz - Protein , 2010 - Wiley Online Library
     
    2. Structure and mechanism of the chalcogen-detoxifying protein TehB from Escherichia coli
    H Choudhury, A Cameron, S Iwata, K Beis - Biochem. J, 2011 - biochemj.org
     
    3. Crystallization and initial X-ray diffraction analysis of the tellurite-resistance S-adenosyl-L-methionine transferase protein TehB from Escherichia coli
    HG Choudhury, K Beis - Acta Crystallographica Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    The STM1608 gene from S. typhimurium codes for the NP_460567 amino acid sequence that is similar to the tellurite resistance protein TehB family (Pfam03848) that utilizes a methyltransferase activity in the detoxification of tellurite (Liu et al., 2000).

    2i6g belongs to the SCOP alpha/beta class, S-adenosyl-L-methionine-dependent methyltransferases superfamily, TehB-like family. DALI structural similarity search top hits are with the following PDB structures:
    PH0226 protein PDB:1ve3 (DALI Z-score 13.9; RMSD 2.8; 14% sequence identity for 146 superimposed residues);
    MJ0882 protein PDB:1dus (DALI Z-score 13.6; RMSD 3.1; 19% sequence identity for 147 superimposed residues);
    HI0319 protein PDB:1im8 (DALI Z-score 13.4; RMSD 2.7; 14% sequence identity for 144 superimposed residues).

    Analysis of the crystallographic packing of 2i6g using the PQS server {Henrick, 1998 #73} indicates that a monomer is the biologically relevant form.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch