.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i02

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of general stress protein of COG3871 (ZP_00108720.1) from Nostoc punctiforme PCC 73102 at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 2i02 Target Id 367233
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS1507,NPUN_22DEC03_CONTIG1_REVISED_GENENPR6570, 2.30.110.10, 90909 Molecular Weight 16965.07 Da.
    Residues 147 Isoelectric Point 5.28
    Sequence matstdrtqeiqklheliknidygmfttvdddgslhsypmsksgdinseatlwfftyagshkvteiehh eqvnvsfsspeqqryvsisgtsqlvkdrnkmrelwkpelqtwfpkgldepdiallkvninqvnywdsts sfkpqtisf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.204
    Matthews' coefficent 2.38 Rfactor 0.177
    Waters 175 Solvent Content 47.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2i02
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. The structure of a Xanthomonas general stress protein involved in citrus canker reveals its flavin-binding property
    E Hilario, Y Li, D Niks, L Fan - Acta Crystallographica Section D: , 2012 - scripts.iucr.org
     

    Protein Summary

    Gene Npun_R6570 from Nostoc punctiforme PCC 73102 encodes the YP_001869771 amino acid sequence (obsolete entry: ZP_00108720), a pyridoxamine 5'-phosphate oxidase-related, FMN-binding protein with significant similarity to proteins from COG3871.

    2i02 has significant structural similarity to proteins with structures classified as SCOP family: PNP-oxidase like [50476].

    Phylogenetic cooccurrence indicates that ZP_00108720 functions may be interdependent with the following proteins:
    ALR3356 [Q8YRT7], ALL4050 [Q8YPZ0], ALL4894 [Q8YMN9], ALL5264 [Q8YLN4], ALL3797 [Q8YQM3], BPHB [PHYB_ANASP] - Cyanobacterial phytochrome B (EC 2.7.3.-), ALR1320 [Q8YX95], ALL4647 [Q8YNC0], ALR0895 [Q8YYF5], and ALL3820 [Q8YQK3].
     
    Analysis of the crystallographic packing of 2i02 using the PQS server {Henrick, 1998 #73} indicates that a tetramer is the biologically relevant form.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch