.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hr2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_663012.1) from Chlorobium tepidum TLS at 2.54 A resolution. To be published
    Site JCSG
    PDB Id 2hr2 Target Id 366651
    Molecular Characteristics
    Source Chlorobium tepidum tls
    Alias Ids TPS1477,NP_663012.1 Molecular Weight 17351.70 Da.
    Residues 158 Isoelectric Point 5.15
    Sequence mkplkevvgaylalsdaqrqlvageydeaaancrrameishtmppeeafdhagfdafchaglaealagl rsfdealhsadkalhyfnrrgelnqdegklwisavysralaldglgrgaeampefkkvvemieerkget pgkermmevaidriaqlgas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.54 Rfree 0.232
    Matthews' coefficent 3.54 Rfactor 0.204
    Waters 88 Solvent Content 64.94

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hr2
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. Improving the accuracy of template-based predictions by mixing and matching between initial models
    T Liu, M Guerquin, R Samudrala - BMC Structural Biology, 2008 - w01.biomedcentral.com
     
    4. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    5. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    6. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary

    The CT2138 gene of C. tepidum TLS encodes the NP_663012 protein of unknown function with close homologs found in various green sulphur bateria (Chlorobium, Pelodictyon,  and Prosthecochloris  species). CT2138 has weak (Pfam e-value=0.14), but detectable (Blast e-value=1e-21) similarity to several families of tetratricopeptide repeat (TPR) containing proteins.

    The 2hr2 structure belongs to the SCOP all alpha class, TPR-like superfamily [48452], CT2138-like family. A DALI search gives hits with the putative peptidyl-prolyl isomerase PDB:2fbn (Z=16), the SGTA protein PDB:2vyi (Z=16), the PLCR protein PDB:2qfc (Z=16), a putative FK506-binding protein (PDB:1qz2; chain A; DALI Z-score 15.3; RMSD 2.9; 16% sequence identity within 132 superimposed residues), and with the tetratricopeptide repeats of the protein phosphatase 5 (PDB:2bug; DALI Z-score 15.1; RMSD 2.5; 19% sequence identity within 117 superimposed residues).

    Analysis of the crystallographic packing of 2hr2 using the PQS server {Henrick, 1998 #73} indicates that a hexamer is the biologically relevant form.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch