.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hr2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of hypothetical protein (NP_663012.1) from Chlorobium tepidum TLS at 2.54 A resolution. To be published
    Site JCSG
    PDB Id 2hr2 Target Id 366651
    Molecular Characteristics
    Source Chlorobium tepidum tls
    Alias Ids TPS1477,NP_663012.1 Molecular Weight 17351.70 Da.
    Residues 158 Isoelectric Point 5.15
    Sequence mkplkevvgaylalsdaqrqlvageydeaaancrrameishtmppeeafdhagfdafchaglaealagl rsfdealhsadkalhyfnrrgelnqdegklwisavysralaldglgrgaeampefkkvvemieerkget pgkermmevaidriaqlgas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.54 Rfree 0.232
    Matthews' coefficent 3.54 Rfactor 0.204
    Waters 88 Solvent Content 64.94

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The CT2138 gene of C. tepidum TLS encodes the NP_663012 protein of unknown function with close homologs found in various green sulphur bateria (Chlorobium, Pelodictyon,  and Prosthecochloris  species). CT2138 has weak (Pfam e-value=0.14), but detectable (Blast e-value=1e-21) similarity to several families of tetratricopeptide repeat (TPR) containing proteins.

    The 2hr2 structure belongs to the SCOP all alpha class, TPR-like superfamily [48452], CT2138-like family. A DALI search gives hits with the putative peptidyl-prolyl isomerase PDB:2fbn (Z=16), the SGTA protein PDB:2vyi (Z=16), the PLCR protein PDB:2qfc (Z=16), a putative FK506-binding protein (PDB:1qz2; chain A; DALI Z-score 15.3; RMSD 2.9; 16% sequence identity within 132 superimposed residues), and with the tetratricopeptide repeats of the protein phosphatase 5 (PDB:2bug; DALI Z-score 15.1; RMSD 2.5; 19% sequence identity within 117 superimposed residues).

    Analysis of the crystallographic packing of 2hr2 using the PQS server {Henrick, 1998 #73} indicates that a hexamer is the biologically relevant form.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch