.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hi0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of putative phosphoglycolate phosphatase (YP_619066.1) from Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365 at 1.51 A resolution. To be Published
    Site JCSG
    PDB Id 2hi0 Target Id 366916
    Molecular Characteristics
    Source Lactobacillus delbrueckii subsp. bulgaricus atcc baa-365
    Alias Ids TPS1489,YP_813060.1, 90341 Molecular Weight 26338.55 Da.
    Residues 239 Isoelectric Point 5.00
    Sequence mkykaaifdmdgtildtsadltsalnyafeqtghrhdftvediknffgsgvvvavtralayeagssres lvafgtkdeqipeavtqtevnrvlevfkpyyadhcqiktgpfpgildlmknlrqkgvklavvsnkpnea vqvlveelfpgsfdfalgeksgirrkpapdmtsecvkvlgvprdkcvyigdseidiqtarnsemdeiav nwgfrsvpflqkhgatvivdtaekleeailge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.51 Rfree 0.19
    Matthews' coefficent 2.18 Rfactor 0.157
    Waters 641 Solvent Content 43.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hi0
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. Cupin: A candidate molecular structure for the Nep1-like protein family
    A Cechin, M Sinigaglia, N Lemke - BMC plant , 2008 - biomedcentral.com
     
    4. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    5. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    6. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary

    The gene YP_813060.1 from Lactobacillus delbrueckii bulgaricus encodes a putative phosphoglycolate phosphatase EC:3.1.3.18, a member of haloacid dehalogenase (HAD)-like hydrolases PF00702.  The enzyme belongs to the class of alpha and beta (a+b) proteins and adopts a HAD-like fold type SCOP56783.  The enzyme is structurally identical to the homologous phosphoglycolate phosphatase from Aquifex aeolicus 2YY6 2NYV.  The enzyme catalyzes the following reaction: 2-phosphoglycolate + H(2)O <=> glycolate + phosphate.  The enzyme participates in glyoxylate and dicarboxylate metabolism.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch