.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hh6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of BH3980 (10176605) from BACILLUS HALODURANS at 2.04 A resolution. To be published
    Site JCSG
    PDB Id 2hh6 Target Id 361188
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1465,10176605 Molecular Weight 12901.04 Da.
    Residues 112 Isoelectric Point 6.13
    Sequence msfiekmigslndkrewkamearakalpkeyhhaykaiqkymwtsggptdwqdtkrifggildlfeega aegkkvtdltgedvaafcdelmkdtktwmdkyrtklndsigrd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.238
    Matthews' coefficent 5.26 Rfactor 0.224
    Waters 78 Solvent Content 76.43

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene BH3980 from Bacillus halodurans probably encodes the NP_244848 protein, a transcriptional regulator from the DUF1048 group (PF06304), homologous to PadR 3HHH (sequence identity with YP_003354695 is 44%) and LmrR 3F8B families of transcription regulators.  

    SCOP classifies 2hh6 inside the left-handed superhelix fold, BH3980-like (super)family. DALI only provides weak hits (Z=10) with the BH3976 protein 2o4t and 2o3l. The structure comparison searches using 2hh6 as query demonstrates significant similarities to these transcription regulators, although several structural features differ. PadR acts as a repressor of padA gene expression in the phenolic acid stress response, which is important in plant-soil ecosystems.  LmrR is PadR-related transcriptional repressor that regulates the production of LmrCD, a major multidrug ABC transporter in Lactococcus lactis. Transcriptional regulation is presumed to follow a drug-sensitive induction mechanism involving the direct binding of transporter ligands to LmrR.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch