.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hag

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structures of two novel dye-decolorizing peroxidases reveal a beta-barrel fold with a conserved heme-binding motif. Proteins 69 223-233 2007
    Site JCSG
    PDB Id 2hag Target Id 360890
    Related PDB Ids 2iiz 
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS1923,NP_716371.1, PF04261, 90484 Molecular Weight 35758.36 Da.
    Residues 311 Isoelectric Point 5.05
    Sequence mdiqnmpreqlgvcaegnlhsvylmfnandnvesqlrpcianvaqyiyeltdqysdsafngfvaigany wdslypesrpemlkpfpamqegnreapaieydlfvhlrcdrydilhlvaneisqmfedlvelveeergf rfmdsrdltgfvdgtenpkgrhrqevalvgsedpefkggsyihvqkyahnlskwhrlplkkqediigrt kqdnieyesedkpltshikrvnlkdengksieilrqsmpygslkeqglmfistcrtpdhfekmlhsmvf gdgagnhdhlmhftsaltgssffapsldflmqfdn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.75 Rfree 0.229
    Matthews' coefficent 3.61 Rfactor 0.191
    Waters 48 Solvent Content 65.66

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hag
    1. DyP-type peroxidases comprise a novel heme peroxidase family
    Y Sugano - Cellular and molecular life sciences, 2009 - Springer
     
    2. Structural basis of enzyme encapsulation into a bacterial nanocompartment
    M Sutter, D Boehringer, S Gutmann - Nature structural & , 2008 - nature.com
     
    3. Crystal structures of two novel dye_decolorizing peroxidases reveal a __barrel fold with a conserved heme_binding motif
    C Zubieta, S Krishna, M Kapoor - Proteins: Structure, , 2007 - Wiley Online Library
     
    4. Identification and structural characterization of heme binding in a novel dye_decolorizing peroxidase, TyrA
    C Zubieta, R Joseph, S Sri Krishna - Proteins: Structure, , 2007 - Wiley Online Library
     
    5. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    6. Identification of DypB from Rhodococcus jostii RHA1 as a Lignin Peroxidase
    M Ahmad, JN Roberts, EM Hardiman, R Singh - Biochemistry, 2011 - ACS Publications
     
    7. Novel identification of expressed genes and functional classification of hypothetical proteins from Neisseria meningitidis serogroup A
    G Bernardini, S Arena, D Braconi, A Scaloni - , 2007 - Wiley Online Library
     
    8. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    9. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    10. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     
    11. Identification and Molecular Characterization of a Novel DyP-Type Peroxidase from Pseudomonas aeruginosa PKE117
    J Li, C Liu, BZ Li, HL Yuan, JS Yang - Applied biochemistry and , 2012 - Springer
     
    12. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     

    Protein Summary

    The SO_0740 gene from S. oneidensis encodes the NP_716371 protein that belongs to the Dyp-type peroxidase protein family (Pfam04261). The NCBI entry is annotated as putative melanin biosynthesis protein TyrA.

    SCOP classifies 2hag in the alpha+beta class, ferredoxin-like fold, dimeric alpha+beta barrel superfamily, Dyp-type peroxidase-like family. 2hag structure is similar to heme peroxidase (PDB structure PDB:2gvk; DALI Z-score 35.3; RMSD 1.6; 33% sequence identity within 282 superimposed residues) and to DyP peroxidase (PDB structure PDB:2d3q; DALI Z-score 25.7, RMSD 2.9; 16% sequence identity within 280 superimposed residues).

    Analysis of the crystallographic packing of 2hag using the PQS server {Henrick, 1998 #73} indicates that a monomer is the biologically relevant form [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (2)

    FileSizeDateAttached by 
    2iiz.jpg
    No description
    54.36 kB19:21, 30 Jun 2008dweekesActions
    2iiz.png
    No description
    31.14 kB19:21, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch