| Title | Crystal structures of two novel dye-decolorizing peroxidases reveal a beta-barrel fold with a conserved heme-binding motif. Proteins 69 223-233 2007 | | Site | JCSG | | PDB Id | | Target Id | 361324 | | Molecular Characteristics | | Source | Bacteroides thetaiotaomicron vpi-5482 | | Alias Ids | TPS1468,NP_810132.1 | Molecular Weight | 35025.62 Da. | | Residues | 316 | Isoelectric Point | 4.90 | | Sequence | mnpfqnsfgghipqdvagkqgenvifivynltdspdtvdkvkdvcanfsamirsmrnrfpdmqfsctmg fgadawtrlfpdkgkpkelstfseikgekytavstpgdllfhirakqmglcfefasildeklkgavvsv dethgfrymdgkaiigfvdgtenpavdenpyhfavigeedadfaggsyvfvqkyihdmvawnalpveqq ekvigrhkfndvelsdeekpgnahnavtnigddlkivranmpfantskgeygtyfigyastfsttrrml enmfigspagntdrlldfstaitgtlffvpsydllgelge | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.60 | Rfree | 0.19 | | Matthews' coefficent | 2.98 | Rfactor | 0.164 | | Waters | 327 | Solvent Content | 58.78 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
BtDyP from Bacteroides thetaiotaomicron descr (strain VPI-5482) is a Dye-decolorizing peroxidase (DyP), a member of a new family of heme-dependent peroxidases recently identified in fungi and bacteria.
Ligand Summary
References
