.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gfh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Protein C20orf147 homolog (17391249) from Mus musculus at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 2gfh Target Id 354784
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS1342,17391249, 289402, 289606, 289338, 282439, 89712, 289627, 89639, 89680 Molecular Weight 27806.62 Da.
    Residues 248 Isoelectric Point 5.74
    Sequence mglsrvravffdldntlidtagasrrgmlevikllqskyhykeeaeiicdkvqvklskecfhpystcit dvrtshweeaiqetkggadnrklaeecyflwkstrlqhmiladdvkamltelrkevrlllltngdrqtq rekieacacqsyfdaiviggeqkeekpapsifyhccdllgvqpgdcvmvgdtletdiqgglnaglkatv winksgrvpltsspmphymvssvlelpallqsidckvsmsv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.259
    Matthews' coefficent 2.54 Rfactor 0.208
    Waters 109 Solvent Content 51.27

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gfh
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches
    R Schwarzenbacher, A Godzik - Section D: Biological , 2007 - scripts.iucr.org
     
    3. A C-terminal phosphatase module conserved in vertebrate CMP-sialic acid synthetases provides a tetramerization interface for the physiologically active enzyme
    M Oschlies, A Dickmanns, T Haselhorst - Journal of molecular , 2009 - Elsevier
     

    Protein Summary

    The gene Nanp from Mus musculus encodes the NP_080362 protein, that belongs to the HAD group (PF00702) and likley functions as a N-acylneuraminate-9-phosphatase (NANP) EC:3.1.3.29.

    The 2gfh structure belongs to the class of alpha and beta proteins (a+b) and reveals haloacid dehalogenase (HAD)-like hydrolase fold type SCOP56783The structure of the homologous enzyme from Homo sapiens has been solved 2W4M (Z=35). Other similar structures according to DALI are the protein PH0459 1x42 (Z=23), the YFNB protein 3i76 (Z=22) and the phosphatase 2om6 (Z=20).

    The enzyme catalyzes the hydrolysis of N-acylneuraminate-9-phosphate to yield N-acylneuraminate.  The enzyme participates in aminosugars metabolism.  

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch