.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gf6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Conserved hypothetical protein (13815598) from Sulfolobus solfataricus at 1.91 A resolution. To be published
    Site JCSG
    PDB Id 2gf6 Target Id 359654
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS1427,13815598, 85245 Molecular Weight 15672.51 Da.
    Residues 134 Isoelectric Point 6.84
    Sequence menieyvfedvvriydtdaqgiahyaayyrfftntiekfikekvgipypivnenlwfviaeshaiyhrp vklgdkltvllnpkilsnktikfefkvlkdgelttegyviqiainpkiwkstempkeimdklsik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.91 Rfree 0.259
    Matthews' coefficent 2.29 Rfactor 0.217
    Waters 265 Solvent Content 45.89

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gf6
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    3. Function-Biased Choice of Additives for Optimization of Protein Crystallization: The Case of the Putative Thioesterase PA5185 from Pseudomonas aeruginosa PAO1
    M Chruszcz, MD Zimmerman, S Wang - Crystal Growth and , 2008 - ACS Publications
     
    4. The GD box: A widespread noncontiguous supersecondary structural element
    V Alva, S Dunin_Horkawicz, M Habeck - Protein , 2009 - Wiley Online Library
     
    5. Structure of the putative thioesterase protein TTHA1846 from Thermus thermophilus HB8 complexed with coenzyme A and a zinc ion
    T Hosaka, K Murayama, M Kato-Murayama - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The SSO2295 (13815598) gene from Sulfolobus solfataricus encodes the NP_343666 protein, a 4-hydroxybenzoyl-CoA thioesterase (4HBT) PF03061 EC 3.1.2.23.  The protein belongs to the class of alpha and beta proteins (a+b) with thioesterase/thiol ester dehydrase-isomerase fold type (beta-alpha-beta(4); 2 layers: alpha/beta) SCOP.  4HBT forms a homotetramer with four active sites.  Each subunit of the 4HBT tetramer adopts a so-called hot-dog fold.  The enzyme catalyzes the final step in the 4-chlorobenzoate degradation pathway in which 4-chlorobenzoate is converted to 4-hydroxybenzoate in certain soil-dwelling bacteria.  Several structure of the enzyme homologues from other organisms have been reported: Pseudomonas Aeruginosa 2O5U [Ref], human 2FOX [Ref].  A number of other proteins also share the hotdog fold. These proteins have related, but distinct, catalytic activities that include metabolic roles such as thioester hydrolysis in fatty acid metabolism [Ref], and degradation of phenylacetic acid and the environmental pollutant 4-chlorobenzoate [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    3. (No Results)

       


      Discuss this publication
    4. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch