.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gd9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of (2636623) from BACILLUS SUBTILIS at 2.30 A resolution. To be published
    Site JCSG
    PDB Id 2gd9 Target Id 359096
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS1416,2636623, _0052.000516_, _0110.002040_, _0023.002889_, _0036.000262_, 85246 Molecular Weight 21735.92 Da.
    Residues 188 Isoelectric Point 5.94
    Sequence mtnnlkqrriildlavtldgfiegkngevdwcimdpdmgftdflnqidtilygrksfdlwgqyipkned pdtekelwklvhskkkyvfsrtqneidnqaifindnileevnklkknpgkdiwlyggaslittfinlgl vdefrlsihpvvlgegkplfidvkqrinlkmvntrtfssgvvqivyhwng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.254
    Matthews' coefficent 3.57 Rfactor 0.207
    Waters 155 Solvent Content 65.30

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene BSU40760 (aka yyaP) from Bacillus subtilis encodes the NP_391956 protein, a putative dihydrofolate reductase PF01872, EC:1.5.1.3, COG0262.

    Pre-SCOP classifies 2gd9 in the alpha/beta class, dihydrofolatereductase-like (super)family. A DALI search hits with reductase like 3jtw (Z=18), and 3ky8 (Z=17). The crystal structure of the homologous enzyme from Thermotoga maritima is available 1D1G (Z=15). 

    Dihydrofolate reductase (DHFR) reduces 7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH as a cofactor. This is an essential step in the biosynthesis of deoxythymidine phosphate because 5,6,7,8-tetrahydrofolate is required to regenerate 5,10-methylenetetrahydrofolate.  The latter is then utilized by thymidylate synthase. Inhibition of DHFR interrupts thymidilate synthesis and DNA replication. Inhibitors of DHFR (such as methotrexate) are used in cancer chemotherapy. 5,6,7,8-tetrahydrofolate also is involved in glycine, serine, and threonine metabolism and aminoacyl-tRNA biosynthesis.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch