.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gb3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Aspartate aminotransferase (tm1698) from Thermotoga maritima at 2.50 A resolution. To be published
    Site JCSG
    PDB Id 2gb3 Target Id 283555
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1310,TM1698, 3.40.640.10 Molecular Weight 44915.50 Da.
    Residues 397 Isoelectric Point 5.63
    Sequence mdvfsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpevfferiyenkpevvyyshsagi welreafasyykrrqrvdvkpenvlvtnggseailfsfavianpgdeilvlepfyanynafakiagvkl ipvtrrmeegfaipqnlesfinertkgivlsnpcnptgvvygkdemrylveiaerhglflivdevysei vfrgefasalsiesdkvvvidsvskkfsacgarvgclitrneelishamklaqgrlapplleqigsvgl lnlddsffdfvretyrervetvlkkleehglkrftkpsgafyitaelpvedaeefarwmltdfnmdget tmvaplrgfyltpglgkkeiriacvlekdllsraidvlmeglkmfcssrisc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.50 Rfree 0.266
    Matthews' coefficent 2.02 Rfactor 0.229
    Waters 190 Solvent Content 39.03

    Pathway

    Reactions found in Metabolic Reconstruction for TM1698

    Name: L-Cysteate:2-oxoglutarate aminotransferase
    Other genes that carryout this rxn: TM1255
    Metabolic Subsystem: Cysteine Metabolism
    Reaction: : Lcyst + akg <==> 3spyr + glu-L
    Classification: EC:2.6.1.1
     
    Name: cysteine transaminase irreversible
    Other genes that carryout this rxn: TM1255
    Metabolic Subsystem: Cysteine Metabolism
    Reaction: : glu-L + mercppyr --> akg + cys-L
    Classification: EC:2.6.1.1
     
    Name: 3-sulfino-alanine transaminase (irreversible)
    Other genes that carryout this rxn: TM1255
    Metabolic Subsystem: Cysteine Metabolism
    Reaction: : 3sala + akg + h --> 3snpyr + glu-L

     
    Name: aspartate transaminase
    Other genes that carryout this rxn: TM1255
    Metabolic Subsystem: Glutamate Metabolism
    Reaction: : akg + asp-L <==> glu-L + oaa
    Classification: EC:2.6.1.1
     
    Name: phenylalanine transaminase
    Other genes that carryout this rxn:TM1040 TM1255
    Metabolic Subsystem: Phenylalanine Tyrosine Tryptophan Biosynthesis
    Reaction: : akg + phe-L <==> glu-L + phpyr
    Classification: EC:2.6.1.58
     
    Name: tyrosine transaminase
    Other genes that carryout this rxn:TM1040 TM1255
    Metabolic Subsystem: Phenylalanine Tyrosine Tryptophan Biosynthesis
    Reaction: : akg + tyr-L <==> 34hpp + glu-L
    Classification: EC:2.6.1.5
     
    Name: L-erythro-4-Hydroxyglutamate:2-oxoglutarate aminotransferase
    Other genes that carryout this rxn: TM1255
    Metabolic Subsystem: Proline Biosynthesis
    Reaction: : akg + e4hglu --> 4h2oglt + glu-L
    Classification: EC:2.6.1.1
     

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gb3
    1. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches
    R Schwarzenbacher, A Godzik - Section D: Biological , 2007 - scripts.iucr.org
     
    2. Autoindexing the diffraction patterns from crystals with a pseudotranslation
    NK Sauter, PH Zwart - Acta Crystallographica Section D: Biological , 2009 - scripts.iucr.org
     
    3. Microbial drug target identification using different computational approaches: Specific application to Pseudomonas aeruginosa
    D Perumal, CS Lim - Innovations in Information , 2008 - ieeexplore.ieee.org
     

    Protein Summary

    The gene TM1698 from Thermotoga maritima encodes the enzyme aspartate aminotransferase (AAT) from class I (fold I) family of pyridoxal phosphate (PLP)-dependent aspartate amino transferases PF00155 COG0075.  The protein belongs to the class of alpha and beta (a+b) proteins and reveals PLP-dependent transferase (a/b/a, mixed beta-sheet of 7 strands) fold type SCOP53382.  The enzyme is involved in amino acid biosynthesis.  The PLP cofactor is covalently attached to a conserved lysine residue through Schiff base linkage, forming aldimine intermediate.  The aldimine intermediate, depending on the reaction, is the substrate in four kinds of reactions: (1) transamination, (2) racemization, (3) decarboxylation (removing COOH groups), and (4) various side-chain reactions depending on the enzyme involved.  The primary structure of the eukaryotic-type enzymes is quite well conserved, whereas the prokaryotic-type AAT is highly divergent (15% of identity) .

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch