.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ga1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of (YP_321193.1) from Anabaena variabilis ATCC 29413 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2ga1 Target Id 360696
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS1451,YP_321193.1, PF04255, 90751 Molecular Weight 11874.86 Da.
    Residues 105 Isoelectric Point 4.56
    Sequence mnkktqlleviaalpeelvdqalnyvqmlqnpiqitpgvcggqarirntripvwtlvayrqqgapdkel lanypgltaedlsaawhyyeqnpeqidreiaqddlv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.218
    Matthews' coefficent 2.80 Rfactor 0.176
    Waters 201 Solvent Content 50.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ga1
    1. Comprehensive comparative-genomic analysis of type 2 toxin-antitoxin systems and related mobile stress response systems in prokaryotes
    K Makarova, Y Wolf, E Koonin - Biology direct, 2009 - biomedcentral.com
     

    Protein Summary

    The gene Ava_0674 from Anabaena variabilis ATCC 29413 encodes the protein YP_321193 from the DUF433 group (PF04255) present only in bacteria and archaea. Its genome neighbor, Ava_0673, is annotated as AAA ATPase.

    2ga1 protein crystallizes as a dimer, with each chain containing 105 residues. Each monomer is composed of two domains. The smaller, N-terminal domain consists of two helices, while the larger C-terminal domain is similar to a "winged helix" repressor DNA binding domain, though it has an additional three stranded beta-sheet. Although the function is not known, the structure is somewhat similar to other DNA binding proteins, which suggests that YP_321193 may have a similar role. Additionally, the "winged helix" domain is associated, in general, with protein-protein interactions.

    SCOP classifes 2ga1 in the all alpha class, homeodomain-like superfamily, Alr1493-like family. A DALI search returns only very weak hits (Z<5). Structural alignment of 2ga1 (in orange) with 1jhg (A), 1dpu (B), 6pax (C), 1xma (D) shows that while 2ga1 does have some common features with other DNA binding proteins, it has an overall fold that is unique when compared to them.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    360696_figure_1.png
    No description
    123.08 kB22:02, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch