.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g0w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Lmo2234 protein (16411704) from Listeria monocytogenes LI2 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 2g0w Target Id 358685
    Molecular Characteristics
    Source Listeria monocytogenes egd-e
    Alias Ids TPS1400,16411704, 289613 Molecular Weight 31576.18 Da.
    Residues 284 Isoelectric Point 4.96
    Sequence mtnangnlkkcpitissytlgtevsfpkrvkvaaengfdgiglraenyvdalaagltdedmlrildehn mkvteveyitqwgtaedrtaeqqkkeqttfhmarlfgvkhincgllekipeeqiivalgelcdraeeli iglefmpysgvadlqaawrvaeacgrdnaqlicdtwhwaranqtaesiknvpadrivsiqlcdvhetpy kelreeslhdrlapgegygdtvgfakilkehgvnprvmgvevisdsmvatgleyaalkvynatkkvlde awpeispr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.238
    Matthews' coefficent 1.99 Rfactor 0.189
    Waters 484 Solvent Content 37.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2g0w
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The gene lmo2234 from Listeria monocytogenes encodes the NP_465758  amino acid sequence that folds into  an alpha/beta TIM barrel SCOP51350 domain found in xylose isomerase and in endonuclease IV PF01261, IolI-like family.  Indeed, the protein structure is highly similar to that of IolI protein from Bacillus subtilis 1I60, which is Deoxyribonuclease IV (phage T4-induced) endodeoxyribonuclease.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch