.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fur

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein 10640715 from Thermoplasma acidophilum at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 2fur Target Id 359680
    Molecular Characteristics
    Source Thermoplasma acidophilum dsm 1728
    Alias Ids TPS1428,10640715, 2.30.110.10, 90130 Molecular Weight 23334.65 Da.
    Residues 208 Isoelectric Point 6.33
    Sequence mavecikdkvtryperasysdedlvamldrnftctvsfidggipyaipmmlasegktiylhgsmksriy gilktgqliaislleingivlakeiknnsinyvsalifgrpyeiddtekkievfrllteklvkgrrdns ikpsyedlngvfvfavkpetfsmkartgpphdtstddiwsgvlpiqhtiseagenapeyvkslygkrifi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.231
    Matthews' coefficent 2.20 Rfactor 0.186
    Waters 272 Solvent Content 43.57

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fur
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. M-TASSER: an algorithm for protein quaternary structure prediction
    H Chen, J Skolnick - Biophysical journal, 2008 - Elsevier
     
    3. The structure of a Xanthomonas general stress protein involved in citrus canker reveals its flavin-binding property
    E Hilario, Y Li, D Niks, L Fan - Acta Crystallographica Section D: , 2012 - scripts.iucr.org
     

    Protein Summary

    The Ta1372 gene from Thermoplasma acidophilum has sequence similarity to proteins of the 'Pyridoxamine 5'-phosphate oxidase' family (PF01243) and an 'uncharacterized conserved protein' COG (COG5015).

    Ta1372 has structural similarity to proteins belonging to the 'PNP-oxidase-like' family of SCOP (FMN-binding split barrel superfamily and fold), and is classified in pre-SCOP as a new protein  domain within this family.  Characterized proteins in this family are involved in electron transfer.

    Analysis of the crystallographic packing of the protein using the PQS server indicates that a dimer is the biologically relevant form.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch