.
The Open Protein Structure Annotation Network
PDB Keyword
.
 

2ftz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Geranyltranstransferase (EC 2.5.1.10) (tm0161) from THERMOTOGA MARITIMA at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 2ftz Target Id 282041
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TM0161 Molecular Weight 31022.42 Da.
    Residues 272 Isoelectric Point 5.41
    Sequence mkkekveerireilrpgwdllteeamlysatvggkrirpllvltlgedlgveeeklldvavavelfhtas lihddlppidnadfrrgkpschrtygediallagdglfflafsqiskignskifeefsetayklllgea mdveferrkmevsqemvermyafktgalfafcfsapfilkgkdhtkmkllgekfgvafqiyddlkdilg sfekvgkdlgkdtekvtlvkkvgiqkaremadkyyeevlkgieseglfrtlfllkelkqmveer
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.203
    Matthews' coefficent 3.32 Rfactor 0.169
    Waters 171 Solvent Content 62.67

    Pathway

    Reactions found in Metabolic Reconstruction for TM0161

    Name: dimethylallyltranstransferase
    Metabolic Subsystem: Terpenoid biosynthesis
    Reaction: : dmpp + ipdp --> grdp + ppi
    Classification: EC:2.5.1.1
     
    Name: geranyltranstransferase
    Metabolic Subsystem: Terpenoid biosynthesis
    Reaction: : grdp + ipdp --> frdp + ppi
    Classification: EC:2.5.1.10
     

    Ligand Information
    Ligands UNL (UNKNOWN) x 2;EDO (1,2-ETHANEDIOL) x 10
    Metals

    Jmol

    Protein Summary

    The TM0161 gene of Thermotoga maritima encodes a geranyltranstransferase (EC 1.5.1.10, PF00348, COG0142). The TM0161 structure is an all-alpha protein with a terpenoid synthase fold and is very similar (backbone rmsd of 1.7 Å over 254 residues with a sequence identity of 31%) to the geranyltranstransferase from Shigella flexneri (PDB id: 2for). The structural similarity also extends to orthologs from Agrobacterium tumefaciens (PDB id: 2h8o), Escherichia coli (PDB ids: 1rqj, 1rtr, 1rqi), and other hyperthermophiles such as Pyrococcus horikoshii (PDB id: 1wy0) and Thermus thermophilus (PDB id: 1wmw). More details on the structure and reaction mechanism can be found in Hosfield 2004, Kloer 2006, K-M Chen 2008.

     

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.

    ABOUT SSL CERTIFICATES
    All content on this site is licensed under a Creative Commons Attribution 3.0 License