.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fmu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Tat-interacting protein 30 kDa (HIV-1 tat interactive protein 2, 30 kDa Homolog) (Human) (16924205) from Mus musculus at 2.30 A resolution. To be published
    Site JCSG
    PDB Id 2fmu Target Id 358966
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS1409,16924205 Molecular Weight 26222.83 Da.
    Residues 236 Isoelectric Point 8.95
    Sequence lpklredfkmqnksvfilgasgetgkvllkeilgqnlfskvtligrrkltfeeeayknvnqevvdfekl dvyasafqghdvgfcclgttrskagaegfvrvdrdyvlksaelakaggckhfnllssrgadksssflyl qvkgeveakveelkfdrlsvfrpgvllcdrqesrpgewlarkffgslpdswasgyavpvvtvvramlnn lvspssgqmellenkailhlgkdrdvpkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.265
    Matthews' coefficent 2.33 Rfactor 0.203
    Waters 49 Solvent Content 47.10

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene Htatip2 from Mus musculus encodes the protein NP_058561, a homologue of human HIV-1 TAT interactive protein TIP30 (PDB ID: 2BKA).  The protein structure represents an NAD binding domain from PF01118, usually found in semialdehyde dehydrogenases.  The 2fmu structure belongs to the class of alpha and beta proteins (a+b) and reveals NAD(P)-binding Rossmann fold type SCOP51734.  

    The human homologue of the protein exhibits pro-apoptotic and anti-metastatic properties.  Although TIP30 has semialdehyde dehydrogenase fold type and is able to specifically bind NADPH, it does not exhibit relevant enzymatic activity [Ref].  The mutagenesis studies, done on the conserved Tyr-Lys-Ser NADPH binding motif, suggest that NADPH binding is essential for its biological activity.  These proteins provide an example of the adaptation of a metabolic enzyme fold to include a regulatory role.  This phenomenon has been also observed in the case of NADH-binding co-repressor CtBP [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch