.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f46

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of NMA1982 from Neisseria meningitidis at 1.5 A resolution provides a structural scaffold for nonclassical, eukaryotic-like phosphatases. Proteins 69 415-421 2007
    Site JCSG
    PDB Id 2f46 Target Id 367330
    Molecular Characteristics
    Source Neisseria meningitidis z2491
    Alias Ids TPS1508,7380613, PF04273 Molecular Weight 17592.08 Da.
    Residues 155 Isoelectric Point 6.91
    Sequence mpsekqpqskgnkmailkldehlyispqltkadaeqiaqlgiktvicnrpdreeesqpdfaqikqwleq agvtgfhhqpvtardiqkhdvetfrqligqaespvlaycrtgtrcsllwgfrraaegmpvdeiirraqa agvnlenfrerldnarv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.41 Rfree 0.228
    Matthews' coefficent 2.01 Rfactor 0.2
    Waters 411 Solvent Content 38.69

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2f46
    1. Crystal structure of NMA1982 from Neisseria meningitidis at 1.5 resolution provides a structural scaffold for nonclassical, eukaryotic_like phosphatases
    S Krishna, L Tautz, Q Xu, D McMullan - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. The highest reflection intensity in a resolution shell
    M Bochtler, G Chojnowski - Acta Crystallographica Section A: , 2007 - scripts.iucr.org
     
    3. Protein tyrosine phosphatase structurefunction relationships in regulation and pathogenesis
    F Bhmer, S Szedlacsek, L Tabernero, A stman - FEBS , 2012 - Wiley Online Library
     
    4. The statistics of the highest E value
    G Chojnowski, M Bochtler - Acta Crystallographica Section A: , 2007 - scripts.iucr.org
     

    Protein Summary

    The gene NMA1982 from Neisseria meningitidis z2491 encodes the YP_002343251 protein, a  putative tyrosine phosphatase from the DUF442 family (PF04273).  

    The 2f46 structure belongs to the class of alpha and beta (a+b) proteins and adopts a phosphotyrosine protein phosphatases II  fold type SCOP52798.  DALI top hits are with cyclin dependent kinase inhibitor-3 protein PDB:1fpz (Z=15), PDB:2i6m (Z=14), the DUF442 protein PDB:3gxh (Z=14) and the phosphatase PDB:1yn9 (Z=14). A similar structure from Arabidopsis thaliana has been determined PDB:1xri (Z=14).  The phosphatase activity of the enzyme was confirmed in vitro [Ref].  The overall fold of this phosphatase resembles that of eukaryotic-like phosphatases, PTP1B in particular PDB:1pty (Z=8).  

    N. meningitidis is an important human pathogen responsible for causing meningitis and septicaemia, which are debilitating diseases that kill thousands of people every year.  Thus, this phosphatase might be a very promising target for therapeutic intervention.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch