.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ets

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structures of MW1337R and lin2004: representatives of a novel protein family that adopt a four-helical bundle fold. Proteins 71 1589-1596 2008
    Site JCSG
    PDB Id 2ets Target Id 374925
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mw2
    Alias Ids TPS1636,NP_646154.1, 90066 Molecular Weight 13814.01 Da.
    Residues 116 Isoelectric Point 5.15
    Sequence mndlvesliyevnnmqqnfenvksqqqdhdfyqtvkpytehidsmlneiklhrefiievpymnsrkfel lianieqlsvechfkrtsrklfieklksvqydlqnildgvtkegtdg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.25 Rfree 0.217
    Matthews' coefficent 2.99 Rfactor 0.175
    Waters 55 Solvent Content 58.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ets
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Crystal structures of MW1337R and lin2004: Representatives of a novel protein family that adopt a four_helical bundle fold
    P Kozbial, Q Xu, HJ Chiu, D McMullan - Proteins: Structure, , 2008 - Wiley Online Library
     

    Protein Summary

    The MW1337 gene of Staphylococcus aureus subsp. aureus MW2 encodes the NP_646154 protein from the DUF1798 family present only in bacteria (Pfam accession number PF08807). Analysis of the genomic neighborhood of MW1337 indicates a possible functional linkage with the genes RecU, penicillin binding protein 1A, and DivIVA.

    SCOP classifies 2ets in the all alpha class, YppE-like (super)family. A structural similarity search with DALI returns as top hits (Z=16) the hypothetical protein YppE structures 2im8 and 2hfi; and the lin2004 protein 2huj.

    The precise function of MW1337 and its orthologs is unknown [Ref]. The orthologous protein yppE (PDB code 2im8) from Bacillus subtilis is induced during sporulation.

    See also similar structure: lin2004 (Listeria innocua, 2HUJ).

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch