.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ess

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of an acyl-ACP thioesterase (NP_810988.1) from Bacteroides thetaiotaomicron VPI-5482 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 2ess Target Id 359110
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS1417,BT2075, PF01643, 87279 Molecular Weight 28404.74 Da.
    Residues 247 Isoelectric Point 5.24
    Sequence mseenkigtyqfvaepfhvdfngrltmgvlgnhllncagfhasdrgfgiatlnednytwvlsrlaield empyqyekfsvqtwvenvyrlftdrnfavidkdgkkigyarsvwaminlntrkpadllalhggsivdyi cdepcpiekpsrikvtsnqpvatltakysdidinghvnsiryiehildlfpielyqtkrirrfemayva esyfgdelsffcdevsenefhvevkkngsevvcrskvife
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.206
    Matthews' coefficent 2.54 Rfactor 0.166
    Waters 159 Solvent Content 51.16

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ess
    1. Crystal structure of human thioesterase superfamily member 2
    Z Cheng, F Song, X Shan, Z Wei, Y Wang - Biochemical and , 2006 - Elsevier
     
    2. Thioesterases: A new perspective based on their primary and tertiary structures
    DC Cantu, Y Chen, PJ Reilly - Protein Science, 2010 - Wiley Online Library
     
    3. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    4. Phylogenetic and experimental characterization of an acyl-ACP thioesterase family reveals significant diversity in enzymatic specificity and activity
    F Jing, DC Cantu, J Tvaruzkova, JP Chipman - BMC , 2011 - biomedcentral.com
     

    Protein Summary

    NP_810988 sequence belongs to the Acyl-acyl carrier protein thioesterase group (PF01643). The structure of Bacteroides thetaiotaomicron descr protein NP_810988.1 consists of two repeats of the alpha + beta fold of Thioesterase/thiol ester dehydrase-isomerases. Each repeat has a two layered beta-alpha-beta(4) structure.

    Inside SCOP, 2ess classifies in the alpha+beta class, Thioesterase/thiol ester dehydrase isomerase superfamily, Acyl-ACP thioesterase-like  family. It is strongly similar (2.2 A RMSD over 130 aa without gaps) to other structures from this fold (for instance hypothetical protein 1s5u ) despite very low sequence similarity (~9% seq. id).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch