| Title | Crystal structure of Queuine tRNA-ribosyltransferase (EC 2.4.2.29) (tRNA-guanine (tm1561) from THERMOTOGA MARITIMA at 1.90 A resolution. To be published | | Site | JCSG | | PDB Id | | Target Id | 283418 | | Molecular Characteristics | | Source | Thermotoga maritima msb8 | | Alias Ids | TPS1300,TM1561 | Molecular Weight | 41426.68 Da. | | Residues | 369 | Isoelectric Point | 6.39 | | Sequence | mefevkktfgkarlgvmklhhgavetpvfmpvgtnasvklltprdleeagaeiilsntfhlmlkpgvei iklhrglhnfmgwkrpiltdsggfqvfslpkiriddegvvfrspidgskvflnpeismevqialgsdic mvfdhcpvpdadyeevkeatertyrwalrskkafktenqalfgivqggiypdlrresalqltsigfdgy aigglsigeersltlemtevtveflpedkpryfmgggspelilelvdrgvdmfdsvfptriarhgtalt wngklnlkasynkrslepvdercgcytcknftrsyihhlfdrgevlgqilltihninfmislmkevrrs iesgtfkelkskvvevyssggvnv | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 1.90 | Rfree | 0.229 | | Matthews' coefficent | 2.62 | Rfactor | 0.193 | | Waters | 655 | Solvent Content | 52.66 |
| Ligand Information | | Ligands | | | Metals | | | |
Protein Summary
The gene TM1561 from Thermotoga maritima encodes an enzyme queuine tRNA-ribosyltransferase PF01702 COG1549 EC:2.4.2.29. Some other common names of this enzyme are tRNA-guanine transferase, tRNA guanine transglycosylase, guanine-tRNA transglycosylase, queuine-tRNA transglycosylase, q-insertase. Queuine is a hypermodified base that occurs in the wobble position of the anticodon of tRNAs of Asp, Asn, His and Tyr . Queuine tRNA-ribosyltransferase catalyzes the incorporation of queuine into tRNA via a base exchange reaction with guanine. In eukaryotes, queuine is directly exchanged into tRNA while in eubacteria, a queuine precursor (preQ1) is incorporated and ultimately modified to queuine [Ref]. The enzyme contains a zinc-binding motif. To date, structures of the enzyme homologues from multiple organisms have been solved (e.g. 1EFZ, Zymomonas mobilis; 1IT8, Pyrococcus horikoshii).
Ligand Summary
References