.
The Open Protein Structure Annotation Network
PDB Keyword
.

2amu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Putative superoxide reductase (EC 1.15.1.2) (SOR) (tm0658) from THERMOTOGA MARITIMA at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2amu Target Id 282530
    Related PDB Ids 3qzb 
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1223,TM0658, 283157 Molecular Weight 14934.32 Da.
    Residues 131 Isoelectric Point 6.07
    Sequence mklsdfiktedfkkekhvpvieapekvkkdekvqivvtvgkeiphpnttehhirwikvffqpdgdpyvy evgryefnahgesvqgpnigavyteptvttvvklnrsgtiialsycnihglwessqkitvee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.202
    Matthews' coefficent 2.10 Rfactor 0.147
    Waters 63 Solvent Content 40.84

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2amu
    1. Superoxide reductases
    AS Pereira, P Tavares, F Folgosa - European journal of , 2007 - Wiley Online Library
     

    Protein Summary

    The TM0658 gene from Thermotoga maritima encodes the NP_228467 protein, a putative superoxide reductase (PFAM:PF01880, COG:COG2033, EC:1.15.1.2). Its genome context shows a likely functional link (score 0.9) with neighboring genes TM0659, a rubredoxin, and TM0657, a rubrerythrin.

    The 2amu structure adopts an immunoglobulin-like beta-sandwich fold, inside the superoxide reductase-like (super)family. DALI top hits are with superoxide reductases like 1dqk (Z=21), 1do6 (Z=19) and the SOXZ protein 2oxg (Z=11). The strong structural similarity (1.4 Å main-chain rmsd over 110 residues with 48% sequence identity) with a homolog from Pyrococcus horikoshii (PDB:2hvb; Z=17) is worth mentioning.

    For more details on the structure and function of this protein, see Yeh 2000.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch