.
The Open Protein Structure Annotation Network
PDB Keyword
.

2aml

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Lmo0035 protein (46906266) from Listeria Monocytogenes 4b F2365 at 1.50 A resolution. To be published
    Site JCSG
    PDB Id 2aml Target Id 358817
    Molecular Characteristics
    Source Listeria monocytogenes str. 4b f2365
    Alias Ids TPS1405,YP_012655.1, 3.40.50.10490 Molecular Weight 40481.86 Da.
    Residues 361 Isoelectric Point 4.98
    Sequence mkptmmtyineeeemcrviladfqtnaekleslvkngakewlilatgsslnaaqsakyyienladvrit ieepfnhlyyeklsshldlvigisqsgqststisalervkkeasvpvvaltsdvtseiaefaditldig sgkervgyvtkgftatvltlmltglhfayktvqidetrfnneisafsraidaipatiaeteafyerwqe efatapkftaigygptvgtckefetkfsetvrvpsqgldleafmhgpylevnpqhriffletasavter lvllrdyeskytpftytvkfgkgeddrtlviptdldeyqapflmilpfqilahhiaelkgnklteriyt dfgvamksktkpgdya
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.168
    Matthews' coefficent 2.02 Rfactor 0.14
    Waters 1061 Solvent Content 39.15

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2aml
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The gene YP_012655.1 from Listeria monocytogenes encodes glucosamine-fructose-6-phosphate aminotransferase EC:2.6.1.16, a member of sugar isomerases family PF01380.  Alternative names: glutamine-fructose-6-phosphate transaminase (isomerizing), GlcN6P synthase, glucosamine-6-phosphate synthase, hexosephosphate aminotransferase.  The enzyme contains double Sugar ISomerases (SIS) fold type domains SCOP53696.  The enzyme catalyzes the following reaction: L-glutamine + D-fructose 6-phosphate <=> L-glutamate + D-glucosamine 6-phosphate.  The enzyme participates in glutamate metabolism and aminosugars metabolism.  The structure of homologous SIS domain from Clostridium difficile is available 3G68.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch