.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ajr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Possible 1-phosphofructokinase (EC 2.7.1.56) (tm0828) from THERMOTOGA MARITIMA at 2.46 A resolution. To be published
    Site JCSG
    PDB Id 2ajr Target Id 282698
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1239,TM0828, 3.40.1190.20, 84650 Molecular Weight 35866.53 Da.
    Residues 319 Isoelectric Point 6.28
    Sequence mvltvtlnpaldreifiedfqvnrlyrindlsktqmspggkginvsialsklgvpsvatgfvggymgki lveelrkisklittnfvyvegetrenieiideknktitainfpgpdvtdmdvnhflrrykmtlskvdcv visgsippgvnegicnelvrlarergvfvfveqtprlleriyegpefpnvvkpdlrgnhasflgvdlkt fddyvklaeklaeksqvsvvsyevkndivatregvwlirskeeidtshllgagdayvagmvyyfikhga nflemakfgfasalaatrrkekympdleaikkeydhftvervk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.46 Rfree 0.24
    Matthews' coefficent 2.94 Rfactor 0.193
    Waters 42 Solvent Content 57.90

    Pathway

    Reactions found in Metabolic Reconstruction for TM0828

    Name: fructose-1-phosphate kinase reversible
    Metabolic Subsystem: Carbohydrate Metabolism
    Reaction: : atp + f1p <==> adp + fdp + h
    Classification: EC:2.7.1.56
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Previously PDB:1O14


    TM0828 from Thermotoga maritima belongs to pfkB protein family (carbohydrate kinase; PF00294).



    Analysis of genomic neighborhood and phylogenetic coocuurrence (using STRING) indicates that TM0828 functions may be interdependent with TM1069 (transcriptional regulator from DEOR family).


    TM0828 has ribokinase-like fold (SCOP sunid:53612) with core: 3 layers: ?/?/?; mixed ?-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest.


    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch