.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a9v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References
    Title Crystal structure of (np_394403.1) from THERMOPLASMA ACIDOPHILUM at 2.45 A resolution. To be published
    Site JCSG
    PDB Id 2a9v Target Id 356213
    Molecular Characteristics
    Source Thermoplasma acidophilum dsm 1728
    Alias Ids TPS1358,NP_394403.1 Molecular Weight 22470.12 Da.
    Residues 200 Isoelectric Point 5.27
    Sequence mlkiyvvdnggqwthrewrvlrelgvdtkivpndidsseldgldglvlsggapnideeldklgsvgkyi ddhnypilgicvgaqfialhfgasvvkakhpefgktkvsvmhsenifgglpseitvwenhndeiinlpd dftlaassatcqvqgfyhktrpiyatqfhpevehtqygrdifrnfigicasyreiqkenfqh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.24 Rfree 0.246
    Matthews' coefficent 2.00 Rfactor 0.176
    Waters 211 Solvent Content 37.99

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The gene Ta0944m from Thermoplasma acidophilum encodes for the protein NP_394403.1, a Type 1 glutamine amidotransferase (GATase1)  domain found in GMP synthetase PF00117.  The domain reveals flavodoxin-like fold type SCOP52171.  GMP synthetase is a glutamine amidotransferase from the de novo purine biosynthetic pathway. Glutamine amidotransferase (GATase) activity catalyse the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. GMP synthetase catalyzes the amination of the nucleotide precursor xanthosine 5'-monophospahte to form GMP.  The crystal structures of homologous domains from other organisms are available: 2D7JPyrococcus horikoshii; 1W18, GLUCONACETOBACTER DIAZOTROPHICUS.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch