.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a6a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Structure of an essential bacterial protein YeaZ (TM0874) from Thermotoga maritima at 2.5 A resolution. Acta Crystallogr.,Sect.F 66 1230-1236 2010
    Site JCSG
    PDB Id 2a6a Target Id 282743
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1241,TM0874, 289581 Molecular Weight 22985.58 Da.
    Residues 206 Isoelectric Point 6.35
    Sequence mnvlaldtsqririglrkgedlfeisytgekkhaeilpvvvkklldeldlkvkdldvvgvgigpggltg lrvgiatvvglvspydipvaplnsfemtakscpadgvvlvarrarkgyhycavylkdkglnplkepsvv sdeeleeitkefspkivlkddllispavlveeserlfrekktihyyeieplylqksiaelnwekkkrg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.235
    Matthews' coefficent 3.25 Rfactor 0.191
    Waters 22 Solvent Content 61.87

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2a6a
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. Structural characterization of Salmonella typhimurium YeaZ, an M22 O_sialoglycoprotein endopeptidase homolog
    CE Nichols, C Johnson, M Lockyer - Proteins: Structure, , 2006 - Wiley Online Library
     
    3. Bacterial resuscitation factors: revival of viable but non-culturable bacteria
    NH Keep, JM Ward, G Robertson - Cellular and molecular , 2006 - Springer
     
    4. A role for the universal Kae1/Qri7/YgjD (COG0533) family in tRNA modification
    B El Yacoubi, I Hatin, C Deutsch, T Kahveci - The EMBO , 2011 - nature.com
     
    5. Structure of an essential bacterial protein YeaZ (TM0874) from Thermotoga maritima at 2.5 A resolution
    Q Xu, D McMullan, L Jaroszewski - Section F: Structural , 2009 - scripts.iucr.org
     
    6. Structural Analysis of the Essential Resuscitation Promoting Factor YeaZ Suggests a Mechanism of Nucleotide Regulation through Dimer Reorganization
    I Aydin, Y Saijo-Hamano, K Namba, C Thomas - PloS one, 2011 - dx.plos.org
     
    7. New variants of known folds: do they bring new biology?
    EV Koonin - Acta Crystallographica Section F: Structural Biology , 2010 - scripts.iucr.org
     
    8. Purification, crystallization and preliminary X-ray crystallographic analysis of the putative Vibrio parahaemolyticus resuscitation-promoting factor YeaZ
    I Aydin, A Dimitropoulos, SH Chen - Section F: Structural , 2011 - scripts.iucr.org
     

    Protein Summary

    YeaZ and its homologs are among the few essential proteins in bacteria for which the specific function remains unknown. The crystal structure of YeaZ from Thermotoga maritima was determined to 2.5 Å. Although this protein belongs to a family of ancient actin-like ATPases, it appears that it has lost the ability to bind ATP, since it lacks some key structural features that are important for interaction with ATP. A conserved surface that is likely important for the function of YeaZ was identified, supporting the hypothesis that YeaZ is a component of a larger protein complex.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch