.
The Open Protein Structure Annotation Network
PDB Keyword
.

283673

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 283673
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2371,TM1820, 282256 Molecular Weight 57036.83 Da.
    Residues 501 Isoelectric Point 6.50
    Sequence mvlvvdygsqysrlitrrirenevysevvfpddkvdlskvdavilsggprsvyeedapklpewfqeykg pvlaicygmqlivkelggevrrgrgeygrtlvelsrdpifegipekvhvwmshgdevvrlpegfhpiav setgviaaatdgkrfwllqfhpevhhteygdrmisnflfnvckleknwkigdlveekirhiketignkk ailalsggvdssvaavlvhraigknlvcvfvdhgllrknereevervfkehfdmnlvvvdarkrflekl rgvtdpekkrkiigeefirvfeeeakkhdveflvqgtiysdviesaasgkttakikshhnvgglpekmn lklveplrdlfkdevrkvgkylgipdriinrhpfpgpglavrvlgevteekleilreadyifietlrkh dyydkvwqafavllpiksvgvkgdarayeyvvalravnsvegmtadwsriphdildeaarritrevkgv grvvyditskppatiewe
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1820

    Name: GMP synthase
    Metabolic Subsystem: Purine Metabolism
    Reaction: : atp + gln-L + h2o + xmp --> amp + glu-L + gmp + h + ppi
    Classification: EC:6.3.5.2
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1820
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch