.
The Open Protein Structure Annotation Network
PDB Keyword
.

283621

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 283621
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2358,TM1767, 89531 Molecular Weight 29555.70 Da.
    Residues 271 Isoelectric Point 6.86
    Sequence mwidcktiarsieertkerveklgftpklvsvactddpsalsylksqrkkaeklgiafeimnvspeeiv stlkklgsdesvngvfvarpfplgldekeilssvpvekdvegvnpanlglllydeeifppctaeaavri leretnlsgkrvtvvgrsvtvgkplalmllkkgrdatvtvchsrtvnleeitknsdivvvavgrahflk knmvkegaividvginyvdgklqgdvdpsveeiarvtpvpggvgqvttallfehvvraaerqrk
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1767

    Name: methenyltetrahydrofolate cyclohydrolase
    Metabolic Subsystem: Folate Metabolism
    Reaction: : h2o + methf <==> 10fthf + h
    Classification: EC:3.5.4.9
     
    Name: methylenetetrahydrofolate dehydrogenase (NADP)
    Metabolic Subsystem: Folate Metabolism
    Reaction: : mlthf + nadp <==> methf + nadph
    Classification: EC:1.5.1.5
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1767
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch