.
The Open Protein Structure Annotation Network
PDB Keyword
.

283606

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 283606
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2350,TM1751 Molecular Weight 37381.70 Da.
    Residues 317 Isoelectric Point 5.89
    Sequence mgvdpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwsthayafppykim drffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiadrykdypetlffeilneph gnltpekwnelleealkvirsidkkhtiiigtaewggisaleklsvpkweknsivtihyynpfefthqg aewvegsekwlgrkwgspddqkhlieefnfieewskknkrpiyigefgayrkadlesrikwtsfvvrem ekrrwswaywefcsgfgvydtlrktwnkdllealiggdsie
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1751

    Name: hydrolysis of galactomannan
    Other genes that carryout this rxn: TM1624 TM1752 TM1192
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : galman6 + h2o --> gal + man
    Classification: EC:3.2.1.4
     
    Name: hydrolysis of glucomannan
    Other genes that carryout this rxn: TM1624 TM1752
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : glcman4 + h2o --> glc-D + man
    Classification: EC:3.2.1.4
     
    Name: hydrolysis of glucomannan
    Other genes that carryout this rxn: TM1624 TM1752
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : glcman6 + h2o --> glc-D + man
    Classification: EC:3.2.1.4
     
    Name: hydrolysis of galactomannan
    Other genes that carryout this rxn: TM1624 TM1752 TM1192
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : galman4 + h2o --> gal + man
    Classification: EC:3.2.1.4
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1751
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch