.
The Open Protein Structure Annotation Network
PDB Keyword
.

283580

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 283580
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2345,TM1724, 89510 Molecular Weight 26400.15 Da.
    Residues 246 Isoelectric Point 6.43
    Sequence mrlegkvclitgaasgigkattllfaqegatviagdiskenldslvkeaeglpgkvdpyvlnvtdrdqi kevvekvvqkygridvlvnnagitrdallvrmkeedwdavinvnlkgvfnvtqmvvpymikqrngsivn vssvvgiygnpgqtnyaaskagvigmtktwakelagrnirvnavapgfietpmteklpekaretalsri plgrfgkpeevaqvilflasdessyvtgqvigidgglvi
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1724

    Name: 3-hydroxy-palmetoyl-ACP synthesis
    Other genes that carryout this rxn:TM0800 TM0798 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + myrsACP + nadph --> 3hpalmACP + ACP + co2 + nadp

     
    Name: Fatty acid biosynthesis (n-C14:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : ddcaACP + h + malACP + nadph --> ACP + co2 + h2o + myrsACP + nadp

     
    Name: Fatty acid biosynthesis (n-C24:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : behenACP + h + malACP + nadph --> ACP + co2 + h2o + lgnACP + nadp

     
    Name: Fatty acid biosynthesis (n-C20:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + ocdcaACP --> ACP + arachACP + co2 + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C16:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + myrsACP + nadph --> ACP + co2 + h2o + hdeACP + nadp

     
    Name: Fatty acid biosynthesis (n-C22:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : arachACP + h + malACP + nadph --> ACP + behenACP + co2 + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C18:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + palmACP --> ACP + co2 + h2o + nadp + octeACP

     
    Name: 3-hydroxy-octadecanoyl-ACP synthesis
    Other genes that carryout this rxn:TM0800 TM0798 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + palmACP --> 3hoctaACP + ACP + co2 + nadp

     
    Name: Fatty acid biosynthesis (n-C20:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + ocdcaACP --> ACP + aracheACP + co2 + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C10:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : actACP + h + malACP + nadph --> ACP + co2 + dcaACP + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C18:2)
    Other genes that carryout this rxn:TM0800 TM0798 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + palmACP --> ACP + co2 + h2o + ocdcyaACP

     
    Name: Fatty acid biosynthesis (n-C12:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : dcaACP + h + malACP + nadph --> ACP + co2 + ddcaACP + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C14:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : ddcaACP + h + malACP + nadph --> ACP + co2 + h2o + nadp + tdeACP

     
    Name: Fatty acid biosynthesis (n-C16:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + myrsACP + nadph --> ACP + co2 + h2o + nadp + palmACP

     
    Name: Fatty acid biosynthesis (n-C18:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + palmACP --> ACP + co2 + h2o + nadp + ocdcaACP

     
    Name: Fatty acid biosynthesis (n-C22:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : arachACP + h + malACP + nadph --> ACP + beheneACP + co2 + h2o + nadp

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1724
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch