The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status NMR Structure
    Target Id 283574
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2342,TM1718, 84709 Molecular Weight 24803.48 Da.
    Residues 220 Isoelectric Point 5.60
    Sequence mvkiaasilacdlarladevkrveehvdmihfdvmdghfvpnisfglpvlkalrketklpisvhlmitn pedyidrfieegadmvaihyestfhlhrlvhrvkdlgarafvainphtpinllseiitdvdgvlvmsvn pgfsgqrfiarslekirnlrkmvkelgleteimvdggvneenasilvkngatilvmgygifrndnyvel iksikqereefad
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1718

    Name: ribulose 5-phosphate 3-epimerase
    Metabolic Subsystem: Pentose Phosphate Pathway
    Reaction: : ru5p-D <==> xu5p-D
    Classification: EC:

    Ligand Information
    Model TM1718
    generated 12/2008

    Protein Summary

    TM1718 encodes D-ribulose 5-phosphate 3-epimerase and has strong similarity to 1rpxA, 1h1yA, 1tqjA, 1tqxA, and 2fliA. TM1718 catalyses the interconversion of D-ribulose 5-phosphate (Ru5P) into D-xylulose 5-phosphate (NCBI:cd00429). The STRING server analysis indicates functional associations between TM1718 and: TM1762 (putative transketolase), TM1717, (probable GTPase engC, EC 3.6.1.-), TM1715, TM0438 (6-phosphogluconate dehydrogenase, decarboxylating), TM1080(sugar-phosphate isomerase), TM0283 (sugar-phosphate isomerase), TM0116(sugar kinase, FGGY family), TM0284(sugar kinase, FGGY family), TM0492 (tryptophanyl-tRNA synthetase, EC, and TM0295 (transaldolase). 

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch