.
The Open Protein Structure Annotation Network
PDB Keyword
.

283510

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 283510
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2325,TM1653, 85047 Molecular Weight 47125.95 Da.
    Residues 434 Isoelectric Point 5.59
    Sequence mraydvilkkrngeklsreeiefmvggyvkgeipdyqmaaflmavyfrhldeeetyyftetmmrsgevl dlseipgtkvdkhstggvgdkttlvvaplvasagvpvakmsgralghtggtidklesipgfrtelslee fiknvkkygiaivgqtgnlvpadkkiyalrdatatvdeisliassimskklaggsdafvldvkfgtgaf mkgfedakklaflmlriaqqhgkkavavlsnmdqplgkavgnslevieaietlkgngpedlkelsltlg almlelagvadfeegkkilqekletgealdkfrllvkaqggnervvddpwrvlpvaeqvvefsaaregf vskidaekvgiasmmlgagrkkkedridhsvgiivekklgdsvkkgeaiarlfvsdrsdvesalkllke ayvisdspsepprvveevik
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1653

    Name: pyrimidine-nucleoside phosphorylase (cytosine)
    Metabolic Subsystem: Pyrimidine Metabolism
    Reaction: : csn + r1p --> cytd + pi
    Classification: EC:2.4.2.2
     
    Name: thymidine phosphorylase
    Metabolic Subsystem: Pyrimidine Metabolism
    Reaction: : pi + thymd <==> 2dr1p + thym
    Classification: EC:2.4.2.4
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1653
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch