.
The Open Protein Structure Annotation Network
PDB Keyword
.

283499

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 283499
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2322,TM1642, 530693 Molecular Weight 60769.32 Da.
    Residues 527 Isoelectric Point 6.97
    Sequence mkrdflgrtlaviedlsveeqmflyektrelkqrwysgedvsdfrikkrnvgiyivfvepstrtkesfi naakfhsgpnvkvnvfdsehssfnkqesytdtfsmltgysdysifvvrtrlegvcrllerrisefasrn gievpsfinagdgkhehptqelldeytfleqngfdnsfihvalvgdllhgrtvhskvnglkifknvkvd lvapeelmmpehyvekmkkngfevrifssireyldqkdvakiwyftrlqlermgedilekvhvlreavt fkkeyldalpegvkfyhplprhkvyptipnfldtlplngwetqarngywvrivllsmfggaleapfdts kkeekpeedfiipapithgskgvqkegkrgikpiengtvidhiakgktpeeiystilkirkilrlydvd sadgifrssdgsfkgyislpdrylskkeikklsaispnttvniiknstvvekyriklpptiygfeelrc knencitnpahgenaspsfvrnekgqficeycetphsfeeiwsi
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1642

    Name: aspartate carbamoyltransferase
    Metabolic Subsystem: Pyrimidine Biosynthesis
    Reaction: : asp-L + cbp --> cbasp + h + pi
    Classification: EC:2.1.3.2
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1642
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch