.
The Open Protein Structure Annotation Network
PDB Keyword
.

283497

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 283497
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2321,TM1640, RER070207001684, 89321 Molecular Weight 51610.67 Da.
    Residues 468 Isoelectric Point 6.71
    Sequence mknrktpmkeqspesrrrnfeevalgytleealeeaqrclqcpthpcvsgcpveidipgfirklrdgkl eesyrilksynnlpavcgrvcpqevqcesrcvvgkmkdsepvaigrlerfvadwaaenleedvkplags kkekvavvgsgpagltaaadlakmgyhvdifeafhkpggvlvygipefrlpkriverevsyirklgvnf hlntvvgktvkvkellseydavfigtgagtpkfmgipgtnlngvysanefltrvnlmkaylfpeydtpi rvgkkvavigagntamdaarsalrlgaekvyivyrrteremparreeyhhaleegieflwltlpiryig dangnveamecvrmelkeadgsgrprpvpiegsnfvlevdmvieaigqgpnrvllsefpglelnergyi kadedtgatsvkgvfaggdivtgaatvikamgagkkaaqfihsyltgewnpwqk
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1640

    Name: glutamate synthase (NADPH)
    Other genes that carryout this rxn: TM1217 TM0397
    Metabolic Subsystem: Glutamate Metabolism
    Reaction: : akg + gln-L + h + nadph --> glu-L + nadp
    Classification: EC:1.4.1.13
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1640
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch