.
The Open Protein Structure Annotation Network
PDB Keyword
.

283485

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 283485
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2315,TM1628, 282185 Molecular Weight 34950.28 Da.
    Residues 315 Isoelectric Point 5.94
    Sequence msfsnemkvfsgnanrplaekianylnlqlgdcevgrfadgeinvrinetvrghdifliqptsppvnen lmellimidafkrasantiavvipyygyarqdrkakgrdpisaklvanlitvagatrvltvdlhaeqiq gffdipvdnlwsypvfaeellkrenivpeetvvvspdvggvrrarrmaerlgtslaildkrrpsdnvae vvniigevedkvvimfddiidtahsivkgaealknagakriiacathgvfsdralerienssidtvyit dtiyhenlpekvkvisvanligeaimrirkhlsvstlfr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1628

    Name: phosphoribosylpyrophosphate synthetase
    Metabolic Subsystem: Purine Biosynthesis
    Reaction: : atp + r5p <==> amp + h + prpp
    Classification: EC:2.7.6.1
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1628
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch