The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 283290
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2269,TM1430, 90001 Molecular Weight 53859.64 Da.
    Residues 482 Isoelectric Point 5.04
    Sequence mkyvlsldqgttssraivfdekgnvvskvnkefrqiyprpgwvehdpveiwesqievakkaieeagikp ediaaigitnqrettivwdkntgkpvynaivwqcrrtapicdelkekgysefirertglvidayfsgtk ikwildnvegvrekaekgevlfgtvdtwliwnltggrvhvtdysnasrtmifnihkldwddeilellni pramlpqvmpsshvygytakdifgveipiagdagdqqaalfgqacfqpgmlkntygtgcfllmntgeka fesksgllttiawgingkvyyalegsifitgaavqwlrdglkiisnaaeteelatkvpdnggvffvpaf vglgapywdmyargliigitrgttrehivravlesiayqtrdvvevmekdsdikvetlrvdggavvnnf lmqfqadilgvpverpvvnettalgaaylaglavgywkdqeeiaslwqldrrfepsmnseererlysk
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1430

    Name: glycerol kinase
    Other genes that carryout this rxn:TM0952
    Metabolic Subsystem: Alternate Carbon Metabolism
    Reaction: : atp + glyc --> adp + glyc3p + h
    Classification: EC:

    Ligand Information
    Model TM1430
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch