.
The Open Protein Structure Annotation Network
PDB Keyword
.

283262

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 283262
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2263,TM1401 Molecular Weight 33449.00 Da.
    Residues 306 Isoelectric Point 5.69
    Sequence maryrvhvndpldkeatqllmnkeelevtsehlekdelmkiipevdvlvvrsatkvtadiieagknlki iaragigldnidvqkakekgikvlntpgasapsvaelamglmlacarhiaratvslkegkwekkalkgk ellgktlgligfgnigqevakralafgmkiiaydpakpetdlpveyvdldtlfkesdfislhvpltest rhiinresiakmkdgviivntarggtideealyeevvsgkvyaagldvfevepptdeirrkllsldnvv atphigastaeaqrrvgielvekifkelgi
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1401

    Name: glycerate dehydrogenase
    Metabolic Subsystem: Serine Metabolism
    Reaction: : h + hpyr + nadh <==> glyc-R + nad
    Classification: EC:1.1.1.29
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1401
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch