.
The Open Protein Structure Annotation Network
PDB Keyword
.

283245

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 283245
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2260,TM1384 Molecular Weight 19765.12 Da.
    Residues 173 Isoelectric Point 6.19
    Sequence mfkldlkrfirdipdfpqkgivfrditpllrnqeafkeaidrmcelvfdrefdlvvapeargfilgaam ayklgkgfvpvrkpgklpyktvyeeyqleygteqlhihedaiekgqkvlivddvlatggtaealirlvk klggevvslaflvelsyleprkrlegydvktlivy
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1384

    Name: guanine phosphoribosyltransferase
    Metabolic Subsystem: Purine Metabolism
    Reaction: : gua + prpp --> gmp + ppi
    Classification: EC:2.4.2.8
     
    Name: adenine phosphoribosyltransferase
    Metabolic Subsystem: Purine Metabolism
    Reaction: : ade + prpp --> amp + ppi
    Classification: EC:2.4.2.7
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1384
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch