.
The Open Protein Structure Annotation Network
PDB Keyword
.

283021

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 283021
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2219,TM1155, 282656 Molecular Weight 57533.31 Da.
    Residues 496 Isoelectric Point 5.78
    Sequence mkcslglekcpddtlrcfpkieqpfgivifgasgdltkrklipalnrlfeagilperffvlgaartkmd dkkfrsrfdanpdflehcsyisvdyqdpesfkqlkntietlikridssnlvfylavppdlyipilenls ktglnekparvviekpfgkdlesarrledtlqkyfqedqifridhylgketvqnilvfrfanfifeeiw nnkfvdhvqitmaedigvehragyfenvgllrdifqnhmlqilaliameppssfngenfrnervkllrs irpfpveeleswivrgqygrgvvngkevpayreepgvakdsnvetfvamklfidnwrwsgvpfylrsgk rlpkkitevavvfkkiphsifagvpsdelepntivftlqpnegislefqvkrpcpgmfpqllsmdfrye dyfgvklpdayerllldvilgdptlfmrrddlevswelldpvlkawendpvrfspyvypagtwgpread llierdgrkwrkl
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1155

    Name: glucose 6-phosphate dehydrogenase
    Metabolic Subsystem: Pentose Phosphate Pathway
    Reaction: : g6p + nadp --> 6pgl + h + nadph
    Classification: EC:1.1.1.49
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1155
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch