.
The Open Protein Structure Annotation Network
PDB Keyword
.

283003

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283003
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS25531,TM1137, 305711 Molecular Weight 39876.28 Da.
    Residues 359 Isoelectric Point 9.49
    Sequence mmkmekklsartnfiltvvflifmalllyladrymdsyklrvvrliaiygimavslnlingitgifslg hagfiligaytaslltlspeqkamsfiiepivpwlanahtdfftatvaggvlaavfafligwpvlrlsg dylaiaslgfaeviriialnaisitngplglkgipeysniwwcygwlfvtvlfmaslvnssygralkai redriaaeamginvfkhqllsfvigaffagvsgslyahwlttidprtttlgpmltfyvlimivlgglgs isgsligaalfailfewlrdleepftffgihvpgikgmrilvisaifilvmifwqrgimgreeltwnnl yrwlfarrrggeek
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1137

    Name: L-threonine transport via ABC system
    Other genes that carryout this rxn:TM1139 TM1138 TM1135 TM1136
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + thr-L[e] --> adp[c] + h[c] + pi[c] + thr-L[c]

     
    Name: L-valine transport via ABC system
    Other genes that carryout this rxn:TM1139 TM1138 TM1135 TM1136
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + val-L[e] --> adp[c] + h[c] + pi[c] + val-L[c]

     
    Name: L-alanine transport via ABC system
    Other genes that carryout this rxn:TM1139 TM1138 TM1135 TM1136
    Metabolic Subsystem: Transport
    Reaction: ala-L[e] + atp[c] + h2o[c] --> adp[c] + ala-L[c] + h[c] + pi[c]

     
    Name: L-leucine transport via ABC system
    Other genes that carryout this rxn:TM1139 TM1138 TM1135 TM1136
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + leu-L[e] --> adp[c] + h[c] + leu-L[c] + pi[c]

     
    Name: L-isoleucine transport via ABC system
    Other genes that carryout this rxn:TM1139 TM1138 TM1135 TM1136
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + ile-L[e] --> adp[c] + h[c] + ile-L[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM1137

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch