.
The Open Protein Structure Annotation Network
PDB Keyword
.

282956

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 282956
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2210,TM1090, 84667 Molecular Weight 48272.61 Da.
    Residues 420 Isoelectric Point 5.91
    Sequence mkyrrikgtndifgeeiwywryveetfrnvcesagieeirtpifeqtelfvrsvgeesdivqkemytfq dkagrsitlrpegtapvvraflenslidrgfqqryyyigpmfryekpqsgrlrqfhqvgfeiigpespk adfevimlvdtflrrlgltkykihlnsigcpvcrknyrealkeyygrildnlcddckrryetnilrlld ckvdheyslnapksvdylcdscrahykklkeylntfeieyvedhtlvrgldyytrtvfevrheglgaqs aiagggrydglfaelggssvpalgfaggieriilalkaegieipmknvhlvyiatlgekafmdgvrlag elrkkglsvdvdimdrklsgqlkhasrmgsryaviigdeelekgivilrdletgdqveidrdfaadyia ervskd
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1090

    Name: Histidyl-tRNA synthetase
    Metabolic Subsystem: tRNA Metabolism
    Reaction: : atp + his-L + trnahis --> amp + histrna + ppi
    Classification: EC:6.1.1.21
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1090
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch