.
The Open Protein Structure Annotation Network
PDB Keyword
.

282931

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282931
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2203,TM1064, BV1071, _0000.000321_, 282125 Molecular Weight 37239.47 Da.
    Residues 332 Isoelectric Point 5.90
    Sequence mstllqiknlrtyfftdegvvkavdgvsfeieegrtlgvvgesgcgksvtarsiikllstagrivsgei lynmdgqmvdlvkfskeeirkvrgrhiamifqepmaafspvytigdqitegmiyhfgitkqearerave llrrvgipkpekmidsypfeysggmrqramiamalscnprlliadepttaldvtiqaqvldllkdlqqe ykmaimmithnmgvvaemadhvvvmylgrvvesapveelfynpkhpytslllrsipvvgkrverlevie gdvpdprnmpkgcrfhprcpymmkgicderepvevevgpehrvscflyggekdgas
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1064

    Name: L-rhamnose transport (ATP-dependent)
    Other genes that carryout this rxn:TM1065 TM1066 TM1063 TM1067
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + rmn[e] --> adp[c] + h[c] + pi[c] + rmn[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1064
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch