.
The Open Protein Structure Annotation Network
PDB Keyword
.

282875

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 282875
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2193,TM1006, _0037.001841_, _0002.001809_, _0087.001827_, _0112.000092_, 89301 Molecular Weight 37536.26 Da.
    Residues 333 Isoelectric Point 5.56
    Sequence mgipkrklgergpevsaiglgcmrmsfgqkklpdrkemiklirtavelginffdtaevygpytneelvg ealepfkgevviatkfgfelyedgrpgwkglnsnpehikkavegslrrlrveaidilyqhrvdpnvpie evagavkelieegkvkhfglceasaetirrahkvcpvdvvqyeysmwwrkpeeellptceelgigfvay splgkgfltgaigenskfdeedsrsriprfqkenlrenlalvelrktiaerkgatpsqialawllaqkp wivpipgttklshlleniggafveltpeelqeindalsrieikgsrypedmekmtyl
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1006
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch