.
The Open Protein Structure Annotation Network
PDB Keyword
.

282713

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282713
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2152,TM0843, 89284 Molecular Weight 34409.07 Da.
    Residues 304 Isoelectric Point 8.71
    Sequence mkliesvpnfsegrrkevvekivaeakkydrvwvldwsmdadhnrsvitlvgepenlinalfdmtkkaa elidlrnhtgqhprmgaadviplvplynttmeecveyskilgrrigeelgipvylyeksatrperqnla dirkgefegffekikdplwkpdfgpdrvhptagvtavgarefliafnvnlgtrdvkiaekiarairfss gglryvkaigvdlkgrgvvqvsinitnhkktplyrvfelikmeaerygvpvlgseivglfplesllktv syylrtdlnakkviesnlleilvresek
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0843

    Name: formimidoyltransferase cyclodeaminase
    Metabolic Subsystem: Folate Metabolism
    Reaction: : 5forthf + glu-L <==> forglu + h + thf
    Classification: EC:2.1.2.5
     
    Name: 5-Formyltetrahydrofolate
    Metabolic Subsystem: Folate Metabolism
    Reaction: : 5fthf + glu-L + h --> Nforglu + thf
    Classification: EC:2.1.2.5
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0843
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch