.
The Open Protein Structure Annotation Network
PDB Keyword
.

282679

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 282679
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2146,TM0809 Molecular Weight 52375.16 Da.
    Residues 467 Isoelectric Point 5.02
    Sequence mdvdlgklffcgfndfneevkeiirkyrptgiliypgvlskeyllmdfmsflskegdflissdheggql evlkyvpsspgnlafgknspdvtyrysrvagkimeivglnmvfapvldllseesssvidirsygsdpki vaehgaracegyleggvipcikhfpghgkaredshltlpvvdapfeklweedllpfrkvlerekkvtvm tahvryssidslpatlsekiitdvlrekigfdglvisdamemsavsnnfsveeivslflnaggnmillg dyrnlpvyyetlvklledgkvqkdkversirtvekylafakknsgvgfladvsmkaveflgfekidhts evtllvpssenlsqadttggdydqipeivsrffevenvvrytvedgpefvegdlifdfvadipnekalk ahlslpaektvyfvlrnpfdvryfegrkivvtrstkpisiykslehflgrcds
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary

    Cytosolic beta-N-acetylhexosaminidase, catalyzes the reaction: chtbs + h2o --> (2) acgam

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch