The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282668
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2143,TM0798 Molecular Weight 32964.34 Da.
    Residues 293 Isoelectric Point 5.66
    Sequence mrafvfpgqgsqysgmakdfsvyesskeiferskkvlgfditeimngdeetlkltenaqpsiyitsyia flelekrgilpdvvaghslgeytalavagvydfetglylvrkrgeymskalepgkgtmaaviglnieti eevvnsiegvyianynshdqvvisglkesvekameilkekgarrvvelmvsspfhtpfleyarekmkee vekvdfkkprwpivmnstakptenpeeikrniieqitgpvlwkqsvdtmkkmgvtefvevgpktvlknl crrmganakhfteilse
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0798

    Name: 3-hydroxy-palmetoyl-ACP synthesis
    Other genes that carryout this rxn:TM0800 TM1724 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + myrsACP + nadph --> 3hpalmACP + ACP + co2 + nadp

    Name: Fatty acid biosynthesis (n-C14:0)
    Other genes that carryout this rxn:TM0800 TM1724 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : ddcaACP + h + malACP + nadph --> ACP + co2 + h2o + myrsACP + nadp

    Name: Fatty acid biosynthesis (n-C24:0)
    Other genes that carryout this rxn:TM0800 TM1724 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : behenACP + h + malACP + nadph --> ACP + co2 + h2o + lgnACP + nadp

    Name: Fatty acid biosynthesis (n-C20:0)
    Other genes that carryout this rxn:TM0800 TM1724 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + ocdcaACP --> ACP + arachACP + co2 + h2o + nadp

    Name: Fatty acid biosynthesis (n-C16:1)
    Other genes that carryout this rxn:TM0800 TM1724 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + myrsACP + nadph --> ACP + co2 + h2o + hdeACP + nadp

    Name: Fatty acid biosynthesis (n-C22:0)
    Other genes that carryout this rxn:TM0800 TM1724 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : arachACP + h + malACP + nadph --> ACP + behenACP + co2 + h2o + nadp

    Name: Fatty acid biosynthesis (n-C18:1)
    Other genes that carryout this rxn:TM0800 TM1724 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + palmACP --> ACP + co2 + h2o + nadp + octeACP

    Name: 3-hydroxy-octadecanoyl-ACP synthesis
    Other genes that carryout this rxn:TM0800 TM1724 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + palmACP --> 3hoctaACP + ACP + co2 + nadp

    Name: Fatty acid biosynthesis (n-C20:1)
    Other genes that carryout this rxn:TM0800 TM1724 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + ocdcaACP --> ACP + aracheACP + co2 + h2o + nadp

    Name: Fatty acid biosynthesis (n-C10:0)
    Other genes that carryout this rxn:TM0800 TM1724 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : actACP + h + malACP + nadph --> ACP + co2 + dcaACP + h2o + nadp

    Name: Fatty acid biosynthesis (n-C18:2)
    Other genes that carryout this rxn:TM0800 TM1724 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + palmACP --> ACP + co2 + h2o + ocdcyaACP

    Name: Fatty acid biosynthesis (n-C12:0)
    Other genes that carryout this rxn:TM0800 TM1724 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : dcaACP + h + malACP + nadph --> ACP + co2 + ddcaACP + h2o + nadp

    Name: Fatty acid biosynthesis (n-C14:1)
    Other genes that carryout this rxn:TM0800 TM1724 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : ddcaACP + h + malACP + nadph --> ACP + co2 + h2o + nadp + tdeACP

    Name: Fatty acid biosynthesis (n-C16:0)
    Other genes that carryout this rxn:TM0800 TM1724 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + myrsACP + nadph --> ACP + co2 + h2o + nadp + palmACP

    Name: Malonyl-CoA-ACP transacylase
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : ACP + malcoa <==> coa + malACP
    Classification: EC:
    Name: Fatty acid biosynthesis (n-C18:0)
    Other genes that carryout this rxn:TM0800 TM1724 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + palmACP --> ACP + co2 + h2o + nadp + ocdcaACP

    Name: Fatty acid biosynthesis (n-C22:1)
    Other genes that carryout this rxn:TM0800 TM1724 TM1169 TM0802 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : arachACP + h + malACP + nadph --> ACP + beheneACP + co2 + h2o + nadp


    Ligand Information
    Model TM0798
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch