.
The Open Protein Structure Annotation Network
PDB Keyword
.

282464

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282464
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2097,TM0591, _0000.000321_, BV1071, _0000.000765_, 89951 Molecular Weight 27611.92 Da.
    Residues 242 Isoelectric Point 6.99
    Sequence mtvlkiedlhkyfgklyvlrgidlevkkgevisiigpsgsgkstllrcinlleeyqrgkiyfkgelith rninrirssigmvfqqfnlfphlsvlnnltlapmkvknmqkdeavekakkllervgliekinekpgnls ggqqqrvaiaralmmdpelmlfdeptsaldpelvkevldvikdlaqsgmtmlivthemrfardvsdrvv fmdegrivemgppekifsnpenertreflehflsv
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0591
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch